TV
TV

Tania Volk

27 Years of Experience
Phoenix, AZ
Broker

Tania Volk is a registered investment advisor at Schwab Wealth Advisory, INC., based in Phoenix, AZ, with 27 years of industry experience. Tania operates on a fee-only basis, meaning they do not earn commissions from product sales. Their practice areas include Estate Planning, Investment Management, Retirement Planning, Tax Planning.

Compensation
N/A
Firm Size
1462 advisors
Number of Clients
Not specified
Average Client Portfolio
Not specified

Fee Structure

Minimum Investment:$500K
Planning is included in investment management

SWAI does not directly charge clients for investment advice. Schwab pays SWAI a fee for the investment advice provided to SWA Accounts. SWAI Representatives provide periodic recommendations to clients about how to allocate assets and which securities to buy, sell and hold in a SWA account.

Loading...

Location

2423 E Lincoln Drive, Phoenix, AZ, 85016

Get directions

History

Regulatory History
Clean regulatory record

No disclosures, customer disputes, or regulatory actions on file.

Disclosures include customer complaints, regulatory actions, and other events that advisors must report to the SEC. A clean record means none have been reported.

Learn about disclosures →
Other Business Activities

Tania sells protein drinks and nutritional supplements to fitness-oriented customers through Life Recovery Wellness. This activity takes about 10-20% of her time.

Employment History
Current Registrations
Schwab Wealth Advisory, INC.
November 2012 - Present · 13 yrs 6 mos
Charles Schwab & CO., INC.Broker
November 2012 - Present · 13 yrs 6 mos
Previous Registrations
J.P. Morgan Securities LLCBroker
April 2012 - September 2012 · 5 mos
Charles Schwab & CO., INC.
February 2004 - December 2011 · 7 yrs 10 mos
Charles Schwab & CO., INC.Broker
February 2004 - December 2011 · 7 yrs 10 mos
Edward JonesBroker
November 2002 - December 2003 · 1 yr 1 mo
TD Waterhouse Investor Services, INC.Broker
June 1998 - October 2002 · 4 yrs 4 mos
Jack White & Company, INC.Broker
November 1997 - June 1998 · 7 mos
State Registrations31 states
ALAZCACOCTDCFLGAHIIDILINKSMAMDMEMINHNMNVNYOHOKORPARITNTXVAWAWI
AdvisorBrokerBoth

You can work with an advisor not registered in your state. Most advisors can legally serve a small number of clients across state lines without registering.

Exams
No exam information available for this advisor.
Tania Volk - Financial Advisor | TrueAdvisor